Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Novus Biologicals | Catalog # NBP3-16193

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5U2F4 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 380-478 of human Methionine Aminopeptidase 2/METAP2 (NP_006829.1). CSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193] - Western blot analysis of extracts of Rat testis, using Methionine Aminopeptidase 2/METAP2 Rabbit mAb (NBP3-16193) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193] - Western blot analysis of extracts of various cell lines, using Methionine Aminopeptidase 2/METAP2 Rabbit mAb (NBP3-16193) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Application
Recommended Usage

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Methionine Aminopeptidase 2/METAP2

METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site. A pseudogene of this gene is located on chromosome 2. [provided by RefSeq]

Alternate Names

Amp2, METAP2, MNPEP, p67eIF2

Gene Symbol

METAP2

Additional Methionine Aminopeptidase 2/METAP2 Products

Product Documents for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)

There are currently no reviews for this product. Be the first to review Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) and earn rewards!

Have you used Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...