Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)
Novus Biologicals | Catalog # NBP3-16193
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5U2F4 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 380-478 of human Methionine Aminopeptidase 2/METAP2 (NP_006829.1). CSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193] - Western blot analysis of extracts of Rat testis, using Methionine Aminopeptidase 2/METAP2 Rabbit mAb (NBP3-16193) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193]
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) [NBP3-16193] - Western blot analysis of extracts of various cell lines, using Methionine Aminopeptidase 2/METAP2 Rabbit mAb (NBP3-16193) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Applications for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)
Application
Recommended Usage
Western Blot
1:1000 - 1:5000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Methionine Aminopeptidase 2/METAP2
Alternate Names
Amp2, METAP2, MNPEP, p67eIF2
Gene Symbol
METAP2
Additional Methionine Aminopeptidase 2/METAP2 Products
Product Documents for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)
There are currently no reviews for this product. Be the first to review Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4) and earn rewards!
Have you used Methionine Aminopeptidase 2/METAP2 Antibody (5U2F4)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...