Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84161

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Methionine Aminopeptidase 2/METAP2. Peptide sequence: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - WB Suggested Anti-METAP2 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human brain
Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161]

Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161]

Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. METAP2 Antibody concentration is 5 ug/ml.
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161]

Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP2-84161] - Host: Rabbit. Target Name: METAP2. Sample Type: Jurkat. Antibody Dilution: 1.0ug/mlMETAP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Applications for Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Methionine Aminopeptidase 2/METAP2

METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site. A pseudogene of this gene is located on chromosome 2. [provided by RefSeq]

Alternate Names

Amp2, METAP2, MNPEP, p67eIF2

Gene Symbol

METAP2

Additional Methionine Aminopeptidase 2/METAP2 Products

Product Documents for Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free and earn rewards!

Have you used Methionine Aminopeptidase 2/METAP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...