MID2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82286

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MID2. Peptide sequence: WGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MID2 Antibody - BSA Free

Western Blot: MID2 Antibody [NBP2-82286]

Western Blot: MID2 Antibody [NBP2-82286]

Western Blot: MID2 Antibody [NBP2-82286] - Host: Rabbit. Target Name: MID2. Sample Type: NCI-H226 Whole Cell lysates. Antibody Dilution: 1.0ug/mlMID2 is supported by BioGPS gene expression data to be expressed in NCIH226

Applications for MID2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MID2

MID2 is a member of the tripartite motif (TRIM) family. The MID motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures in the cytoplasm. Its function has not been identified. Alternate splicing of the gene encoding MID2 results in two transcript variants encoding different isoforms.

Alternate Names

EC 6.3.2.-, FLJ37715, FLJ41813, FXY2midin-2, midin 2, Midin-2, midline 2, Midline defect 2, Midline-2, RING finger protein 60, RNF60midline-2, TRIM1probable E3 ubiquitin-protein ligase MID2, tripartite motif protein 1, Tripartite motif-containing protein 1

Gene Symbol

MID2

Additional MID2 Products

Product Documents for MID2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MID2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MID2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MID2 Antibody - BSA Free and earn rewards!

Have you used MID2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...