MMAB Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86602
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for MMAB Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: MMAB Antibody [NBP1-86602]
Immunocytochemistry/Immunofluorescence: MMAB Antibody [NBP1-86602] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602]
Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602]
Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602] - Staining of human prostate shows strong granular cytoplasmic psotivity in glandular cells.Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602]
Immunohistochemistry-Paraffin: MMAB Antibody [NBP1-86602] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.Western Blot: MMAB Antibody - BSA Free [NBP1-86602]
Analysis in human cell line MCF-7 and human cell line U-2 OS.Immunohistochemistry-Paraffin: MMAB Antibody - BSA Free [NBP1-86602]
Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.Western Blot: MMAB Antibody - BSA Free [NBP1-86602] -
Knockdown of MMAB increases LDLR expression and activity and decreases cholesterol biosynthesis in vitro.a Representative images of DiI-LDL uptake in Huh7 cells transfected with a non-silencing siRNA (NS) or siRNA MMAB (siMMAB) and incubated with 30 μg/ml DiI-LDL for 8 h at 37 C. Red, DiI-LDL; blue, nuclei stained with TO-PRO-3 iodide (TOPRO). Scale bar, 10 μm. Flow cytometry analysis of DiI-LDL specific binding and uptake in Huh7 cells transfected with NS siRNA or siMMAB and incubated with 30 μg/ml DiI-LDL for 8 h at 37 C (uptake) or 90 min at 4 C (binding) is shown below. Data are mean +/- s.e.m. of three independent experiments. Statistical comparisons by two-sided unpaired Student’s t test. b, c qRT-PCR (b) and Western analysis (c) of SREBP2-responsive genes in Huh7 cells transfected with an NS control siRNA or siMMAB. HSP90 was used as a loading control. Quantification compared to HSP90 is shown in panel (c). Data are mean +/- s.e.m. of three (c) or four (b) independent experiments in duplicate. Statistical comparisons by two-sided unpaired Student’s t test. d Sterol content of Huh7 cells transfected with NS siRNA or siMMAB. Lipids were extracted and analyzed by GC-MS. “Total sterols" were calculated as the sum of all sterols that could be detected. Data are mean +/- s.e.m. of three independent experiments. Statistical comparisons by two-sided unpaired Student’s t test. e Effect of MMAB knockdown on [1,2-14C]-acetate incorporation into cholesterol as determined by HPLC. Huh7 cells were treated as in (d). Data are representative of three independent experiments. Source data are provided as a Source Data file. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34750386), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for MMAB Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MMAB
Alternate Names
aquocob(I)alamin vitamin B12s adenosyltransferase, ATP:cob(I)alamin adenosyltransferase, ATP:corrinoid adenosyltransferase, ATR, cblB, c-diamide adenosyltransferase, mitochondrial, cob, Cob(I)alamin adenosyltransferase, cob(I)yrinic acid a, EC 2.5.1.17, methylmalonic aciduria (cobalamin deficiency) cblB type, methylmalonic aciduria (cobalamin deficiency) type B, Methylmalonic aciduria type B protein, MGC20496
Entrez Gene IDs
326625 (Human)
Gene Symbol
MMAB
UniProt
Additional MMAB Products
Product Documents for MMAB Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MMAB Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for MMAB Antibody - BSA Free
Customer Reviews for MMAB Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MMAB Antibody - BSA Free and earn rewards!
Have you used MMAB Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...