MMP-16/MT3-MMP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69349

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MMP16(matrix metallopeptidase 16 (membrane-inserted)) The peptide sequence was selected from the N terminal of MMP16 (NP_005932). Peptide sequence ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MMP-16/MT3-MMP Antibody - BSA Free

Western Blot: MMP-16/MT3-MMP Antibody [NBP1-69349]

Western Blot: MMP-16/MT3-MMP Antibody [NBP1-69349]

Western Blot: MMP16 Antibody [NBP1-69349] - This Anti-MMP16 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Applications for MMP-16/MT3-MMP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP-16/MT3-MMP

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another soluble form of the protein. Both forms of the protein activate MMP2 by cleavage.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another a soluble form of the protein. Both forms of the protein activate MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.

Long Name

Matrix Metalloproteinase 16/Membrane Type 3 MMP

Alternate Names

MMP16, MT3-MMP

Entrez Gene IDs

4325 (Human)

Gene Symbol

MMP16

UniProt

Additional MMP-16/MT3-MMP Products

Product Documents for MMP-16/MT3-MMP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP-16/MT3-MMP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MMP-16/MT3-MMP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMP-16/MT3-MMP Antibody - BSA Free and earn rewards!

Have you used MMP-16/MT3-MMP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...