MMP-25/MT6-MMP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17275

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MMP-25/MT6-MMP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MMP-25/MT6-MMP Antibody [NBP3-17275]

Immunocytochemistry/ Immunofluorescence: MMP-25/MT6-MMP Antibody [NBP3-17275]

Immunocytochemistry/Immunofluorescence: MMP-25/MT6-MMP Antibody [NBP3-17275] - Staining of human cell line THP-1 shows localization to plasma membrane.

Applications for MMP-25/MT6-MMP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP-25/MT6-MMP

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as metastasis and arthritis. Most MMPs are secreted as inactive proproteins which are then activated when cleaved by extracellular proteinases. The protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily, and is attached to the plasma membrane via a glycosylphosphatidyl inositol anchor. The encoded protein is thought to inactivate alpha-1 proteinase inhibitor, a major tissue protectant against proteolytic enzymes released by activated neutrophils, facilitating the transendothelial migration of neutrophils to inflammatory sites in response to bacterial infection or inflammation. The encoded protein may also play a role in tumor invasion and metastasis through activation of MMP2. The gene has previously been referred to as MMP20 but has been renamed MMP25.

Long Name

Matrix Metalloproteinase 25/Membrane Type 6 MMP

Alternate Names

Leukolysin, MMP25, MT6-MMP

Gene Symbol

MMP25

Additional MMP-25/MT6-MMP Products

Product Documents for MMP-25/MT6-MMP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP-25/MT6-MMP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MMP-25/MT6-MMP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMP-25/MT6-MMP Antibody - BSA Free and earn rewards!

Have you used MMP-25/MT6-MMP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...