Monoamine Oxidase B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35587

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 400-490 of human Monoamine Oxidase B (MAOB) (NP_000889.3).

Sequence:
TYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Monoamine Oxidase B Antibody - BSA Free

Monoamine Oxidase B Antibody

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Rat liver using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Monoamine Oxidase B Antibody

Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of U2OS cells using Monoamine Oxidase B(Monoamine Oxidase B(MAOB)) Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Monoamine Oxidase B Antibody

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Monoamine Oxidase B Antibody

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human liver using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Monoamine Oxidase B Antibody

Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of L929 cells using Monoamine Oxidase B(Monoamine Oxidase B(MAOB)) Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Monoamine Oxidase B Antibody

Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunocytochemistry/ Immunofluorescence: Monoamine Oxidase B Antibody [NBP3-35587] - Immunofluorescence analysis of NIH/3T3 cells using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Monoamine Oxidase B Antibody

Western Blot: Monoamine Oxidase B Antibody [NBP3-35587] -

Western Blot: Monoamine Oxidase B Antibody [NBP3-35587] - Western blot analysis of lysates from HeLa cells, using Monoamine Oxidase B(MAOB) Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Monoamine Oxidase B Antibody

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Monoamine Oxidase B Antibody

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] -

Immunohistochemistry: Monoamine Oxidase B Antibody [NBP3-35587] - Immunohistochemistry analysis of paraffin-embedded Human colon using Monoamine Oxidase B(MAOB) Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Monoamine Oxidase B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Monoamine Oxidase B

Monoamine Oxidase B is encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

Long Name

Amine oxidase [flavin-containing] B

Alternate Names

EC 1.4.3.21, EC 1.4.3.4, MAO-B, MAOB

Gene Symbol

MAOB

Additional Monoamine Oxidase B Products

Product Documents for Monoamine Oxidase B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Monoamine Oxidase B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Monoamine Oxidase B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Monoamine Oxidase B Antibody - BSA Free and earn rewards!

Have you used Monoamine Oxidase B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...