MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Novus Biologicals | Catalog # NB110-57131CL1

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Feline (96%), Primate (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

CoraFluor 1

Antibody Source

Monoclonal Mouse IgG1 Clone # IU5C1
Loading...

Product Specifications

Immunogen

A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]

Epitope

Residues 14-19 (PLWDWN) of the human protein.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Chicken (88%), Bovine (87%), Drosophila melanogaster (72%).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.

Scientific Data Images for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Product Feature: CoraFluor Probes for TR-FRET

CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.

Applications for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NB110-57131. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS

Preservative

No Preservative

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark. Do not freeze.

Background: MRP1

Multidrug Resistance Protein 1 (MRP1) is an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein. MRP1 is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumours. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump.

Specifically, MRP1 mediates the export of organic anions and drugs from the cytoplasm. It is through this function, that MRP1 is able to confer resistance to anticancer drugs. MRP1 antibodies are therefore useful tools for cancer testing and research.

Long Name

Multi-drug Resistance Protein 1

Alternate Names

ABCC1, GS-X

Gene Symbol

ABCC1

Additional MRP1 Products

Product Documents for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Sold for research purposes only under agreement from Massachusetts General Hospital, US Patent No. 12,134,721. A license is required for development of new commercial assay platforms (e.g., microarrays, microfluidics), diagnostic use or other unlicensed uses. Please contact Technical Support for further details: techsupport@bio-techne.com.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

There are currently no reviews for this product. Be the first to review MRP1 Antibody (IU5C1) [CoraFluor™ 1] and earn rewards!

Have you used MRP1 Antibody (IU5C1) [CoraFluor™ 1]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies