MRPS24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92140

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS24 Antibody - BSA Free

Western Blot: MRPS24 Antibody [NBP1-92140]

Western Blot: MRPS24 Antibody [NBP1-92140]

Western Blot: MRPS24 Antibody [NBP1-92140] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: MRPS24 Antibody [NBP1-92140]

Western Blot: MRPS24 Antibody [NBP1-92140]

Western Blot: MRPS24 Antibody [NBP1-92140] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
MRPS24 Antibody - BSA Free Western Blot: MRPS24 Antibody - BSA Free [NBP1-92140]

Western Blot: MRPS24 Antibody - BSA Free [NBP1-92140]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
MRPS24 Antibody - BSA Free Western Blot: MRPS24 Antibody - BSA Free [NBP1-92140]

Western Blot: MRPS24 Antibody - BSA Free [NBP1-92140]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
MRPS24 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: MRPS24 Antibody [NBP1-92140]

Immunocytochemistry/ Immunofluorescence: MRPS24 Antibody [NBP1-92140]

Staining of human cell line PC-3 shows localization to vesicles.

Applications for MRPS24 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS24

MRPS24, also known as Mitochondrial Ribosomal Protein S24, is a 167 amino acid isoform that is 19 kDa, and is a piece of the mitochondrial ribosome subunit 28S, which is involved in protein synthesis. There is no current research being conducted between MRPS24 and any diseases or disorders. MRPS24 has been linked to translation and other biological processes, through which it interacts with ICT1, DDX56, RABGGTB, KBTBD7, and AARS2.

Alternate Names

28S ribosomal protein S24, mitochondrial, bMRP47, bMRP-47, mitochondrial 28S ribosomal protein S24, mitochondrial ribosomal protein S24, MRP-S24HSPC335, S24mt

Gene Symbol

MRPS24

Additional MRPS24 Products

Product Documents for MRPS24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS24 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS24 Antibody - BSA Free and earn rewards!

Have you used MRPS24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...