MRPS9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30501

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RLRHTAFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS9 Antibody - BSA Free

Western Blot: MRPS9 Antibody [NBP2-30501]

Western Blot: MRPS9 Antibody [NBP2-30501]

Western Blot: MRPS9 Antibody [NBP2-30501] - Analysis using Anti-MRPS9 antibody NBP2-30501 (A) shows similar pattern to independent antibody NBP2-30429 (B).
Immunocytochemistry/ Immunofluorescence: MRPS9 Antibody [NBP2-30501]

Immunocytochemistry/ Immunofluorescence: MRPS9 Antibody [NBP2-30501]

Immunocytochemistry/Immunofluorescence: MRPS9 Antibody [NBP2-30501] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining in human testis and pancreas tissues using anti-MRPS9 antibody. Corresponding MRPS9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501]

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human testis shows high expression.

Applications for MRPS9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS9

MRPS9, also known as Mitochondrial Ribosomal Protein S9, contains a 46 kDa isoform that is 396 amino acids in length, and is involved in mitochondrial protein synthesis. Current research is being conducted on the relationship between MRPS9 and a variety of diseases and disorders, including Parkinson's disease, mycobacterium tuberculosis, pneumonia, and malaria. The protein is associated with translation, the peptide biosynthetic process, and the detection of DNA damage, and has been found to interact with several proteins, such as HAP1, RBM4B, ICT1, CCNDBP1, and MPHOSPH6.

Alternate Names

mitochondrial ribosomal protein S9, MRP-S9RPMS9S9mt28S ribosomal protein S9, mitochondrial

Gene Symbol

MRPS9

UniProt

Additional MRPS9 Products

Product Documents for MRPS9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS9 Antibody - BSA Free and earn rewards!

Have you used MRPS9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...