Myelin PLP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35912

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 90-150 of human Myelin PLP (NP_000524.3).

Sequence:
GFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Myelin PLP Antibody - BSA Free

Myelin PLP Antibody

Western Blot: Myelin PLP Antibody [NBP3-35912] -

Western Blot: Myelin PLP Antibody [NBP3-35912] - Western blot analysis of various lysates, using Myelin PLP Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Myelin PLP Antibody

Immunohistochemistry: Myelin PLP Antibody [NBP3-35912] -

Immunohistochemistry: Myelin PLP Antibody [NBP3-35912] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Myelin PLP Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Myelin PLP Antibody

Immunocytochemistry/ Immunofluorescence: Myelin PLP Antibody [NBP3-35912] -

Immunocytochemistry/ Immunofluorescence: Myelin PLP Antibody [NBP3-35912] - Immunofluorescence analysis of paraffin-embedded mouse brain using Myelin PLP Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Myelin PLP Antibody

Immunocytochemistry/ Immunofluorescence: Myelin PLP Antibody [NBP3-35912] -

Immunocytochemistry/ Immunofluorescence: Myelin PLP Antibody [NBP3-35912] - Immunofluorescence analysis of paraffin-embedded rat brain using Myelin PLP Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Myelin PLP Antibody

Immunohistochemistry: Myelin PLP Antibody [NBP3-35912] -

Immunohistochemistry: Myelin PLP Antibody [NBP3-35912] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Myelin PLP Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for Myelin PLP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myelin PLP

Human PLP (also known as lipophilin) is a 30 kDa protein (277 amino acids) found in myelin of the CNS and PNS. Expressed by oligodendrocytes and Schwann cells, PLP stabilizes myelin by preventing lipid bilayer fusion, and aids in compaction. Different mutations of the human PLP gene product result in two neurological disorders - Pelizaeus-Merzbacher disease and Spastic Paraplegia type 2.

Long Name

Proteolipid Protein

Alternate Names

DM-20, Lipophilin, MMPL, PLP1, SPG2

Gene Symbol

PLP1

Additional Myelin PLP Products

Product Documents for Myelin PLP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myelin PLP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Myelin PLP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myelin PLP Antibody - BSA Free and earn rewards!

Have you used Myelin PLP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...