MYL6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54376

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MYL6(myosin, light chain 6, alkali, smooth muscle and non-muscle) The peptide sequence was selected from the N terminal of MYL6. Peptide sequence CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MYL6 Antibody - BSA Free

Western Blot: MYL6 Antibody [NBP1-54376]

Western Blot: MYL6 Antibody [NBP1-54376]

Western Blot: MYL6 Antibody [NBP1-54376] - Human 721_B, Antibody Dilution: 1.0 ug/ml MYL6 is supported by BioGPS gene expression data to be expressed in 721_B.
Immunohistochemistry: MYL6 Antibody [NBP1-54376]

Immunohistochemistry: MYL6 Antibody [NBP1-54376]

Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Staining of human Prostate.
Western Blot: MYL6 Antibody [NBP1-54376]

Western Blot: MYL6 Antibody [NBP1-54376]

Western Blot: MYL6 Antibody [NBP1-54376] - HepG2 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: MYL6 Antibody [NBP1-54376]

Immunohistochemistry: MYL6 Antibody [NBP1-54376]

Immunohistochemistry: MYL6 Antibody [NBP1-54376] - Human Skeletal Muscle.

Applications for MYL6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYL6

MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Alternate Names

ESMLC, LC17, LC17A, LC17B, LC17-GI, LC17-NM, MLC1SM, MLC-3, MLC3NM, MLC3SM, Myosin light chain 3, Myosin light chain A3, Myosin light chain alkali 3, myosin light polypeptide 6,17 kDa myosin light chain, myosin, light chain 6, alkali, smooth muscle and non-muscle, myosin, light polypeptide 6, alkali, smooth muscle and non-muscle, Smooth muscle and nonmuscle myosin light chain alkali 6

Gene Symbol

MYL6

UniProt

Additional MYL6 Products

Product Documents for MYL6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MYL6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MYL6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MYL6 Antibody - BSA Free and earn rewards!

Have you used MYL6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...