MYL7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81016

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MYL7 Antibody - BSA Free

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016] - Staining in human heart muscle and skeletal muscle tissues using NBP1-81016 antibody. Corresponding MYL7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016]

Immunohistochemistry-Paraffin: MYL7 Antibody [NBP1-81016] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for MYL7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYL7

Myosins are a large family of motor proteins that share the common features of ATP hydrolysis, actin binding andpotential for kinetic energy transduction. Originally isolated from muscle cells (hence the name), almost alleukaryotic cells are now known to contain myosins. Structurally, mysoins contain a head domain that binds to actinfilaments (microfilaments) and is the site of ATP hydrolysis. The tail domain interacts with cargo molecules, and theneck acts as a linker between the head and tail and is the site of regulatory myosin light chain binding. There are 17myosin families and the most well characterized is myosin II. Myosin II is found predominantly in myocytes andmediates plus-ended movement along microfilaments. It is involved in muscle contraction through cyclic interactionswith actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin lightchain kinase (MLCK) and by intracellular Ca2+ concentrations.

Alternate Names

atrial isoform, light polypeptide 7, regulatory, MLC-2a, MYL2A, MYLC2AMLC2a, myosin, light chain 7, regulatory

Entrez Gene IDs

58498 (Human)

Gene Symbol

MYL7

UniProt

Additional MYL7 Products

Product Documents for MYL7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MYL7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MYL7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MYL7 Antibody - BSA Free and earn rewards!

Have you used MYL7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...