MYO18A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93035

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1970-2054 of human MYO18A (NP_510880.2). SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MYO18A Antibody - Azide and BSA Free

Western Blot: MYO18A AntibodyAzide and BSA Free [NBP2-93035]

Western Blot: MYO18A AntibodyAzide and BSA Free [NBP2-93035]

Western Blot: MYO18A Antibody [NBP2-93035] - Analysis of extracts of various cell lines, using MYO18A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Applications for MYO18A Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:1000-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MYO18A

Myo18A/Myosin XVIIIA is an unconventional myosin that contains a lysine and glutamine (KE)-rich domain and a PDZ domain. The KE and PDZ domains appear to direct subcellular localization of the Myo18A variants. It is a dimeric actin binding protein that may play a role in the stabilization and organization of the actin cytoskeleton. Recently a cell surface form of Myo18A has been identified as the receptor for surfactant protein A, a lipid-associated lung collectin that mediates innate and adaptive immune responses in the lungs.

Alternate Names

KIAA0216DKFZp686L0243, MAJN, Molecule associated with JAK3 N-terminus, myosin 18A, Myosin containing a PDZ domain, myosin containing PDZ domain, myosin XVIIIA, myosin-XVIIIa, MYSPDZ, SP-A receptor subunit SP-R210 alphaS, SPR210

Gene Symbol

MYO18A

Additional MYO18A Products

Product Documents for MYO18A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MYO18A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MYO18A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MYO18A Antibody - Azide and BSA Free and earn rewards!

Have you used MYO18A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...