Myosin 1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87739

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse, Rat, Avian - Chicken

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Myosin 1B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVA

Reactivity Notes

Chicken reactivity reported in scientific literature (PMID: 25812521). Rat reactivity reported in the scientific literature (PMID: 26940917). Mouse reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Myosin 1B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Myosin 1B Antibody [NBP1-87739]

Immunocytochemistry/ Immunofluorescence: Myosin 1B Antibody [NBP1-87739]

Immunocytochemistry/Immunofluorescence: Myosin 1B Antibody [NBP1-87739] - Staining of human cell line A-431 shows positivity in plasma membrane and cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli and in cells in tubules.
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human liver shows moderate membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739]

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.
Myosin 1B Antibody - BSA Free

Immunohistochemistry: Myosin 1B Antibody - BSA Free [NBP1-87739] -

In mouse kidney Myo1b is found in PT cells.In kidney cross-sections treated with Hoechst stain to identify nuclei (C, blue), Myo1b stained with anti-Myo1b antibodies (B, red) co-localized with Lotus tetragonolobus lectin, a marker for PTs (A, green). D is a merged image of A-C. The arrows identify the corresponding region in each panel. Scale bar = 20 μm. A’-D’ are control images of sections stained with lectin (A’), isotype antibodies (B’), and Hoechst (C’); D’ is a merge of A’-C’. The arrows, which identify PTs in A’, point to the corresponding location in each panel. Scale bar = 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/26361046), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Myosin 1B Antibody - BSA Free

Immunohistochemistry: Myosin 1B Antibody - BSA Free [NBP1-87739] -

Myo1b localizes to the brush border of renal PT cells.In mouse kidney cross-sections, Myo1b (A, green) identified with anti-Myo1b antibodies was at the brush border of PT cells identified by staining of apical microvilli with anti-actin antibodies (B, red). C, Hoechst stain. D, Merge. Scale bar = 20 μm. A’–D’ are control images of renal PT cells using rabbit IgG (A’). B’ is stained with anti-actin antibodies. C’ is stained with Hoechst, and D’ is a merged image. The arrows point to the corresponding location in each image. Scale bar = 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/26361046), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Myosin 1B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-87739 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myosin 1B

Myosin 1B is a motor protein which is involved in neuronal development, membrane trafficking/dynamics and functions including cell migration, vesicular transport and neurite outgrowth. Myosin 1B is known to have interactions with other proteins such as MAP3K3, RIPK3, BRF2, EIF4A2 and CIAO1. Myosin 1B has been studied in relation to neuronitis, amebiasis and dysentery.

Alternate Names

MMIa, MMI-alpha, MYH-1c, MYO1B variant protein, Myosin I alpha, myosin IB, myosin-I alpha, myosin-Ib, myr1

Gene Symbol

MYO1B

Additional Myosin 1B Products

Product Documents for Myosin 1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myosin 1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Myosin 1B Antibody - BSA Free

Customer Reviews for Myosin 1B Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Myosin 1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Myosin 1B Antibody
    Name: Luiz Alexandre Magno
    Application: Western Blot
    Sample Tested: Mouse brain
    Species: Mouse
    Verified Customer | Posted 10/17/2018
    Western blot of whole brain of mice in different developmental stages. The molecular weight of the protein is around 130-140 KDa.
    t works very well at 1:1,000 in the brain but I would also suggest trying lower dilutions in tissues with lower expression of this type of myosin.
    Myosin 1B Antibody - BSA Free NBP1-87739

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies