Myosin 1E Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53151

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Myosin 1E Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MYO1E(myosin IE) The peptide sequence was selected from the middle region of MYO1E (NP_004989). Peptide sequence PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Myosin 1E Antibody - BSA Free

Western Blot: Myosin 1E Antibody [NBP1-53151]

Western Blot: Myosin 1E Antibody [NBP1-53151]

Western Blot: Myosin 1E Antibody [NBP1-53151] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Myosin 1E Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myosin 1E

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.

Alternate Names

HuncM-IC, MGC104638, MYO1Cmyosin-IC, MYO1E variant protein, myosin IE, Myosin-Ic, myosin-Ie

Entrez Gene IDs

4643 (Human); 71602 (Mouse); 25484 (Rat)

Gene Symbol

MYO1E

UniProt

Q12965 (Human)

Additional Myosin 1E Products

Product Documents for Myosin 1E Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myosin 1E Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin 1E Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myosin 1E Antibody - BSA Free and earn rewards!

Have you used Myosin 1E Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies