Myosin Phosphatase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35077

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Myosin Phosphatase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Myosin Phosphatase (NP_002471.1).

Sequence:
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Myosin Phosphatase Antibody - BSA Free

Myosin Phosphatase Antibody

Immunoprecipitation: Myosin Phosphatase Antibody [NBP3-35077] -

Immunoprecipitation: Myosin Phosphatase Antibody [NBP3-35077] - Immunoprecipitation analysis of 200 ug extracts of HeLa cells, using 3 ug Myosin Phosphatase antibody. Western blot was performed from the immunoprecipitate using Myosin Phosphatase antibody at a dilution of 1:1000.
Myosin Phosphatase Antibody

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] -

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] - Immunofluorescence analysis of HeLa cells using Myosin Phosphatase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Myosin Phosphatase Antibody

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] -

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] - Immunofluorescence analysis of PC-12 cells using Myosin Phosphatase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Myosin Phosphatase Antibody

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] -

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] - Immunofluorescence analysis of NIH/3T3 cells using Myosin Phosphatase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Myosin Phosphatase Antibody

Western Blot: Myosin Phosphatase Antibody [NBP3-35077] -

Western Blot: Myosin Phosphatase Antibody [NBP3-35077] - Western blot analysis of various lysates using Myosin Phosphatase Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Myosin Phosphatase Antibody

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] -

Immunocytochemistry/ Immunofluorescence: Myosin Phosphatase Antibody [NBP3-35077] - Immunofluorescence analysis of U2OS cells using Myosin Phosphatase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Myosin Phosphatase Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myosin Phosphatase

The major protein phosphatase-1 (PP1) is composed of 3 subunits with apparent molecular mass of 110-130, 37 & 20 kDa. The 110-130 kDa component act as a regulatory subunit known as myosine binding (MBS) or myosine phosphatae targeting subunit (MYPT). The N-terminal portion of MYPT binds to both PP1c-delta and phosphorylated myosin, thereby increasing myosin phosphatase activity. Two isoform of MYPT have been identified (MYPT1 & MYPT2) and share 61% sequence identity. While MYPT1 is widely distributed in human tissues, MYPT2 is mostly detected in brain and heart.

Alternate Names

MBSmyosin phosphatase, target subunit 1, MGC133042, Myosin phosphatase target subunit 1, Myosin phosphatase-targeting subunit 1, MYPT1protein phosphatase 1 regulatory subunit 12A, protein phosphatase 1, regulatory (inhibitor) subunit 12A, Protein phosphatase myosin-binding subunit

Gene Symbol

PPP1R12A

Additional Myosin Phosphatase Products

Product Documents for Myosin Phosphatase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myosin Phosphatase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin Phosphatase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myosin Phosphatase Antibody - BSA Free and earn rewards!

Have you used Myosin Phosphatase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies