n-Myc Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-95112

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 168-267 of human n-Myc (NP_005369.2). AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for n-Myc Antibody - BSA Free

Western Blot: n-Myc AntibodyBSA Free [NBP2-95112]

Western Blot: n-Myc AntibodyBSA Free [NBP2-95112]

Western Blot: n-Myc Antibody [NBP2-95112] - Analysis of extracts of HeLa cells, using MYCN antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: n-Myc Antibody - BSA Free [NBP2-95112]

Immunocytochemistry/ Immunofluorescence: n-Myc Antibody - BSA Free [NBP2-95112]

Immunocytochemistry/Immunofluorescence: n-Myc Antibody [NBP2-95112] - Analysis of mouse brain using MYCN Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry: n-Myc Antibody [NBP2-95112] - Analysis of rat brain using MYCN Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry-Paraffin: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry-Paraffin: n-Myc Antibody [NBP2-95112] - Mouse brain using MYCN antibody (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry-Paraffin: n-Myc Antibody - BSA Free [NBP2-95112]

Immunohistochemistry-Paraffin: n-Myc Antibody [NBP2-95112] - Rat brain using MYCN antibody (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for n-Myc Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Simple Western

1:25-1:100

Western Blot

1:100 - 1:500
Application Notes
See Simple Western Antibody Database for Simple Western validation: Tested in KG-1 whole-cell lysate, separated by Size, antibody dilution of 1:25, 1:50, 1:100, apparent MW was 50 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: n-Myc

n-Myc is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas.

Alternate Names

BHLHE37, bHLHe37N-myc proto-oncogene protein, Class E basic helix-loop-helix protein 37, MODED, neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene, N-myc, NMYCneuroblastoma MYC oncogene, ODED, oncogene NMYC, pp65/67, v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived, v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)

Gene Symbol

MYCN

Additional n-Myc Products

Product Documents for n-Myc Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for n-Myc Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for n-Myc Antibody - BSA Free

There are currently no reviews for this product. Be the first to review n-Myc Antibody - BSA Free and earn rewards!

Have you used n-Myc Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...