NALP12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85555

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NALP12 Antibody - BSA Free

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555]

Immunohistochemistry-Paraffin: NALP12 Antibody [NBP1-85555] - Staining of human prostate shows no positivity in glandular cells as expected.

Applications for NALP12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NALP12

NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP12, have an N-terminal pyrin (MEFV; MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1; MIM 147678) via their involvement in multiprotein complexes called inflammasomes. NALP12 may mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.

Alternate Names

FCAS2, Monarch-1, NACHT, leucine rich repeat and PYD containing 12, NACHT, LRR and PYD domains-containing protein 12, NALP12LRR and PYD containing protein 12, NLR family, pyrin domain containing 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 12, PYPAF7Monarch1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide, RNO2

Gene Symbol

NLRP12

Additional NALP12 Products

Product Documents for NALP12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NALP12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NALP12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NALP12 Antibody - BSA Free and earn rewards!

Have you used NALP12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...