NCCRP1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25005PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCCRP1

Source: E.coli

Amino Acid Sequence: WEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25005It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25005PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NCCRP1

Non-specific cytotoxic cells (NCCs) in teleosts and their evolutionary homologue are a subpopulation of lymphocytes with properties that distinguish them from either B- or T-cells. One such property is that NCC/natural killer (NK)/lymphokine activated killer (LAK) cells express spontaneous, non-major histocompatibility complex restricted cytotoxic activity. NCC and LAK lyse a variety of transformed murine and human B-cell, T-cell and myeloid targets. A 32 kDa membrane protein [non-specific cytotoxic cell receptor protein (NCCRP-1)] expressed by NCC and certain mammalian NK/LAK cells mediates this cytotoxicity. NCCRP-1 is evolutionarily conserved and is found in species ranging from marine and freshwater teleosts to higher mammals.

Alternate Names

LOC342897, NCCRP-1, nonspecific cytotoxic cell receptor protein 1 homolog, non-specific cytotoxic cell receptor protein 1 homolog, non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)

Gene Symbol

NCCRP1

Additional NCCRP1 Products

Product Documents for NCCRP1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NCCRP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for NCCRP1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review NCCRP1 Recombinant Protein Antigen and earn rewards!

Have you used NCCRP1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for NCCRP1 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Is the product NBP2-13642 reactive to fish NCCRP1, specifically carp?

    A:

    The immunogen of NCCRP1 antibody NBP2-13642 is less than 65% homologous to carp, so we would not recommend this antibody for your purposes. However, NCCRP1 antibody NB100-2071 may be suitable, as it has been validated in catfish.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...