NDRG2 Antibody (6A5) - Azide and BSA Free

Novus Biologicals | Catalog # H00057447-M03

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Biological Validation

Species Reactivity

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 6A5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP

Specificity

NDRG2 - NDRG family member 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for NDRG2 Antibody (6A5) - Azide and BSA Free

Knockdown Validated: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0013.jpg
Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03]

Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Immunocytochemistry-Immunofluorescence-H00057447-M03-img0005.jpg
Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03]

Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Immunohistochemistry-H00057447-M03-img0007.jpg
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0008.jpg
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0009.jpg
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0011.jpg
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0010.jpg
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0014.jpg
Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03]

Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Immunocytochemistry-Immunofluorescence-H00057447-M03-img0006.jpg
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - Analysis of NDRG2 expression in Hela S3 NE.
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0012.jpg
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03]

NDRG2-Antibody-6A5-Western-Blot-H00057447-M03-img0015.jpg
ELISA: NDRG2 Antibody (6A5) [H00057447-M03]

ELISA: NDRG2 Antibody (6A5) [H00057447-M03]

ELISA: NDRG2 Antibody (6A5) [H00057447-M03] - Detection limit for recombinant GST tagged NDRG2 is approximately 0.03ng/ml as a capture antibody.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation & reduces intracellular glucose levels of breast cancer cells. (E) & (F) SK-BR-3 cells cultured to glucose medium at concentrations of 0, 5, 25, 50 & 100 mM for 24 hrs, & then the protein or mRNA was extracted for analysis by immunoblotting (E) or real-time PCR (F). beta -actin used as a loading control. The data presented means ± SD; error bars represented SD from 3 replicative wells. *P < 0.05 & **P < 0.01 versus control group. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation & reduces intracellular glucose levels of breast cancer cells. (A) T-47D, MCF-7, Bcap37, MDA-MB-231 & SK-BR-3 cells collected for the extraction of proteins & analysed for N-myc downstream-regulated gene 2 (NDRG2) expression by immunoblotting. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. (A) SK-BR-3 cells were fixed & incubated with primary antibodies against N-myc downstream-regulated gene 2 (NDRG2) or glucose transporter 1 (GLUT1) & with fluorescein isothiocyanate or a cyanine 3 secondary antibody. Green fluorescence indicates NDRG2 expression, red fluorescence indicates GLUT1 expression & blue fluorescence indicates nuclear staining. The results of the merged images reveal that NDRG2 & GLUT1 were colocalised in the cytoplasm. (B) Immunoprecipitation (IP) assays were performed with whole-cell lysates of SK-BR-3 cells pretreated with protein A–conjugated sepharose beads. Whole-cell lysates were probed for input. The antibodies for immunoprecipitation & Western blot (WB) analyses were carried out as indicated. The locations of various proteins are indicated by arrowheads. IgG, Immunoglobulin G. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] -

Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 decreases the glucose uptake & GLUT1 protein levels in SK-BR-3-based subcutaneously xenograft tumours. The experiments illustrated are described in the Methods section. (A) Tumour growth was assessed every 3 days until day 21 treatment by measuring two perpendicular diameters & calculating the volume in cubic centimetres. Ad-LacZ, adenovirus expressing LacZ; Ad-NDRG2, adenovirus expressing NDRG2; PFU, Plaque-forming units. The data presented are means ± SD; error bars represent SD from 6 mice. *P < 0.05 & **P < 0.01 versus phosphate-buffered saline (PBS) or Ad-LacZ. (B) Tumour cells were dissociated from xenograft tumours & suspended in PBS after the number of cells was counted. Next, the glucose uptake of cells in each group was detected. The data presented are means ± SD of three independent experiments; error bars represent SD from 6 mice. *P < 0.05 & **P < 0.01 versus PBS or Ad-LacZ. (C) Intratumoural protein expression was assessed by N-myc downstream-regulated gene 2 (NDRG2) & glucose transporter 1 (GLUT1) IHC staining. Representative images are shown. Original magnification: 400 x; Scale bars = 50 μm. (D) Proteins of the xenograft tumours from each group were extracted & analysed by immunoblotting to quantify NDRG2 & GLUT1 protein changes. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03] -

Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival & negatively correlated with GLUT1 in breast carcinoma. Kaplan–Meier analysis was carried out according to N-myc downstream-regulated gene 2 (NDRG2) expression levels of disease-free survival (A) & overall survival (B). (C) Serial immunostained sections for NDRG2 & glucose transporter 1 (GLUT1) in breast cancer & normal tissues were analysed. Original magnification, 40× (top) & 400× (bottom); scale bars = 50 μm. (D) Protein was extracted from matched breast tumour tissue (T) & adjacent normal tissue (N) & subjected to immunoblot analysis to examine NDRG2 & GLUT1 expression. beta -actin served as a loading control. P: patient. Relative expression levels of NDRG2 (E) & GLUT1 (F) in human breast cancer & adjacent normal tissue are shown. immunoreactivity score distribution of cancer & adjacent normal tissue were represented with black & brown closed circles, respectively. The horizontal lines presented are means; error bars represented SD from 30 samples. P < 0.01 was considered a statistically significant difference. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] -

Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. (A) SK-BR-3 cells were fixed & incubated with primary antibodies against N-myc downstream-regulated gene 2 (NDRG2) or glucose transporter 1 (GLUT1) & with fluorescein isothiocyanate or a cyanine 3 secondary antibody. Green fluorescence indicates NDRG2 expression, red fluorescence indicates GLUT1 expression & blue fluorescence indicates nuclear staining. The results of the merged images reveal that NDRG2 & GLUT1 were colocalised in the cytoplasm. (B) Immunoprecipitation (IP) assays were performed with whole-cell lysates of SK-BR-3 cells pretreated with protein A–conjugated sepharose beads. Whole-cell lysates were probed for input. The antibodies for immunoprecipitation & Western blot (WB) analyses were carried out as indicated. The locations of various proteins are indicated by arrowheads. IgG, Immunoglobulin G. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 downregulates GLUT1 by promoting its ubiquitination. (A), (C) & (E) SK-BR-3 cells were infected with an adenovirus carrying N-myc downstream-regulated gene 2 (Ad-NDRG2) at 1, 5 & 10 multiplicity of infection (MOI) or Ad-LacZ for 48 hours. (B), (D) & (F) T-47D cells were transfected with NDRG2 small interfering RNA (siRNA) 10, 25 & 100 pmol or control siRNA for 48 hours. Next, cell proteins or mRNA were extracted & analysed by immunoblotting (A) & (B) or by real-time PCR (C) to (F). beta -actin was used as a loading control. (C) – (F) The data presented are the means ± SD of three independent experiments; error bars represent SD from 3 replicative wells. *P < 0.05 & **P < 0.01 versus control group. (G) SK-BR-3 cells were infected with 10 MOI Ad-NDRG2 or Ad-LacZ for 48 hours & then treated with 2 μM, 6 μM or 8 μM MG-132 for 4 hours. Next, the protein was extracted & analysed by immunoblotting. (H) Cell fractions were prepared from the SK-BR-3 cells infected with 10 MOI Ad-NDRG2 or Ad-LacZ for 48 hours, & the membrane & cytosolic fractions of endogenous glucose transporter 1 (GLUT1) protein were detected. Tubulin & beta -actin served as loading controls. (I) SK-BR-3 cells were transfected with hemagglutinin (HA)-ubiquitin plasmid for 6 hours & infected with Ad-NDRG2 or Ad-LacZ for another 48 hours. Subsequently, the cell lysates were collected & analysed by immunoprecipitation (IP) & immunoblotting with GLUT1 & HA antibodies. WB, Western blot. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 downregulates GLUT1 by promoting its ubiquitination. (A), (C) & (E) SK-BR-3 cells were infected with an adenovirus carrying N-myc downstream-regulated gene 2 (Ad-NDRG2) at 1, 5 & 10 multiplicity of infection (MOI) or Ad-LacZ for 48 hours. (B), (D) & (F) T-47D cells were transfected with NDRG2 small interfering RNA (siRNA) 10, 25 & 100 pmol or control siRNA for 48 hours. Next, cell proteins or mRNA were extracted & analysed by immunoblotting (A) & (B) or by real-time PCR (C) to (F). beta -actin was used as a loading control. (C) – (F) The data presented are the means ± SD of three independent experiments; error bars represent SD from 3 replicative wells. *P < 0.05 & **P < 0.01 versus control group. (G) SK-BR-3 cells were infected with 10 MOI Ad-NDRG2 or Ad-LacZ for 48 hours & then treated with 2 μM, 6 μM or 8 μM MG-132 for 4 hours. Next, the protein was extracted & analysed by immunoblotting. (H) Cell fractions were prepared from the SK-BR-3 cells infected with 10 MOI Ad-NDRG2 or Ad-LacZ for 48 hours, & the membrane & cytosolic fractions of endogenous glucose transporter 1 (GLUT1) protein were detected. Tubulin & beta -actin served as loading controls. (I) SK-BR-3 cells were transfected with hemagglutinin (HA)-ubiquitin plasmid for 6 hours & infected with Ad-NDRG2 or Ad-LacZ for another 48 hours. Subsequently, the cell lysates were collected & analysed by immunoprecipitation (IP) & immunoblotting with GLUT1 & HA antibodies. WB, Western blot. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 decreases the glucose uptake & GLUT1 protein levels in SK-BR-3-based subcutaneously xenograft tumours. The experiments illustrated are described in the Methods section. (A) Tumour growth was assessed every 3 days until day 21 treatment by measuring two perpendicular diameters & calculating the volume in cubic centimetres. Ad-LacZ, adenovirus expressing LacZ; Ad-NDRG2, adenovirus expressing NDRG2; PFU, Plaque-forming units. The data presented are means ± SD; error bars represent SD from 6 mice. *P < 0.05 & **P < 0.01 versus phosphate-buffered saline (PBS) or Ad-LacZ. (B) Tumour cells were dissociated from xenograft tumours & suspended in PBS after the number of cells was counted. Next, the glucose uptake of cells in each group was detected. The data presented are means ± SD of three independent experiments; error bars represent SD from 6 mice. *P < 0.05 & **P < 0.01 versus PBS or Ad-LacZ. (C) Intratumoural protein expression was assessed by N-myc downstream-regulated gene 2 (NDRG2) & glucose transporter 1 (GLUT1) IHC staining. Representative images are shown. Original magnification: 400 x; Scale bars = 50 μm. (D) Proteins of the xenograft tumours from each group were extracted & analysed by immunoblotting to quantify NDRG2 & GLUT1 protein changes. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation & reduces intracellular glucose levels of breast cancer cells. (B) SK-BR-3 cells with low NDRG2 expression infected by an adenovirus carrying NDRG2 (Ad-NDRG2) or negative control LacZ (Ad-LacZ), & T-47D cells with high NDRG2 transfected with small interfering RNA targeting NDRG2 (NDRG2 siRNA) or negative control siRNA (Con siRNA). Thereafter proteins extracted from these cells & analysed by immunoblotting. beta -actin used as a loading control. Before being cultured in 25 mM high-glucose (H.G.) or 5.5 mM low-glucose (L.G.) medium, SK-BR-3 cells infected by Ad-NDRG2 (C) & T-47D cells transfected by NDRG2 siRNA (D). Cell proliferation was detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay for 1 to 5 days.Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NDRG2 Antibody (6A5)

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] -

Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival & negatively correlated with GLUT1 in breast carcinoma. Kaplan–Meier analysis was carried out according to N-myc downstream-regulated gene 2 (NDRG2) expression levels of disease-free survival (A) & overall survival (B). (C) Serial immunostained sections for NDRG2 & glucose transporter 1 (GLUT1) in breast cancer & normal tissues were analysed. Original magnification, 40× (top) & 400× (bottom); scale bars = 50 μm. (D) Protein was extracted from matched breast tumour tissue (T) & adjacent normal tissue (N) & subjected to immunoblot analysis to examine NDRG2 & GLUT1 expression. beta -actin served as a loading control. P: patient. Relative expression levels of NDRG2 (E) & GLUT1 (F) in human breast cancer & adjacent normal tissue are shown. immunoreactivity score distribution of cancer & adjacent normal tissue were represented with black & brown closed circles, respectively. The horizontal lines presented are means; error bars represented SD from 30 samples. P < 0.01 was considered a statistically significant difference. Image collected & cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NDRG2 Antibody (6A5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NDRG2

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Alternate Names

DKFZp781G1938, FLJ25522, KIAA1248cytoplasmic protein Ndr1, NDR1-related protein NDR2, NDRG family member 2, protein NDRG2, Protein Syld709613, syld709613 protein, SYLDN-myc downstream regulator 2

Entrez Gene IDs

57447 (Human); 29811 (Mouse); 171114 (Rat)

Gene Symbol

NDRG2

OMIM

605272 (Human)

Additional NDRG2 Products

Product Documents for NDRG2 Antibody (6A5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDRG2 Antibody (6A5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NDRG2 Antibody (6A5) - Azide and BSA Free

Customer Reviews for NDRG2 Antibody (6A5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NDRG2 Antibody (6A5) - Azide and BSA Free and earn rewards!

Have you used NDRG2 Antibody (6A5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...