NDUFAF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89382

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFAF3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFAF3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human fallopian tube, kidney, prostate and testis using Anti-NDUFAF3 antibody NBP1-89382 (A) shows similar protein distribution across tissues to independent antibody NBP2-48638 (B).
Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry-Paraffin: NDUFAF3 Antibody [NBP1-89382] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry: NDUFAF3 Antibody [NBP1-89382]

Immunohistochemistry: NDUFAF3 Antibody [NBP1-89382] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
NDUFAF3 Antibody - BSA Free Western Blot: NDUFAF3 Antibody - BSA Free [NBP1-89382]

Western Blot: NDUFAF3 Antibody - BSA Free [NBP1-89382]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
NDUFAF3 Antibody - BSA Free Western Blot: NDUFAF3 Antibody - BSA Free [NBP1-89382]

Western Blot: NDUFAF3 Antibody - BSA Free [NBP1-89382]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for NDUFAF3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFAF3

NDUFAF3 encodes a nuclear protein of unknown function. The similar rat nuclear protein is predominantly expressed in testis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]. Transcript Variant: This variant (5) contains an in-frame segment of the coding region, and uses a downstream start codon, compared to variant 1. Isoform b has a shorter N-terminus, compared to isoform a. Variants 2, 3, 4 and 5 encode the same isoform (b).

Alternate Names

C3orf60, chromosome 3 open reading frame 60, DKFZp564J0123, DKFZP564J0123,2P1, E3-3, MGC10527, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3, nuclear protein E3-3

Gene Symbol

NDUFAF3

Additional NDUFAF3 Products

Product Documents for NDUFAF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFAF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFAF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFAF3 Antibody - BSA Free and earn rewards!

Have you used NDUFAF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies