NDUFB6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92172

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFB6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (83%). Human reactivity reported in scientific literature (PMID: 25605331).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFB6 Antibody - BSA Free

Western Blot: NDUFB6 Antibody [NBP1-92172]

Western Blot: NDUFB6 Antibody [NBP1-92172]

Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: NDUFB6 Antibody [NBP1-92172]

Immunocytochemistry/ Immunofluorescence: NDUFB6 Antibody [NBP1-92172]

Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172]

Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172]

Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
NDUFB6 Antibody - BSA Free Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
NDUFB6 Antibody - BSA Free Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
NDUFB6 Antibody - BSA Free Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
NDUFB6 Antibody - BSA Free Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Immunohistochemistry: NDUFB6 Antibody - BSA Free [NBP1-92172]

Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
NDUFB6 Antibody - BSA Free Western Blot: NDUFB6 Antibody - BSA Free [NBP1-92172]

Western Blot: NDUFB6 Antibody - BSA Free [NBP1-92172]

Analysis in human cell line NB4.

Applications for NDUFB6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFB6

NDUFB6 is encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Alternate Names

B17, CI, CI-B17, complex I, mitochondrial respiratory chain, B17 subunit, Complex I-B17, MGC13675, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, NADH-ubiquinone oxidoreductase B17 subunit, NADH-ubiquinone oxidoreductase beta subunit, 6

Gene Symbol

NDUFB6

Additional NDUFB6 Products

Product Documents for NDUFB6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFB6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NDUFB6 Antibody - BSA Free

Customer Reviews for NDUFB6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFB6 Antibody - BSA Free and earn rewards!

Have you used NDUFB6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies