Neuro D4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80040

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human DPF1. Peptide sequence KELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCAD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Neuro D4 Antibody - BSA Free

Western Blot: Neuro D4 Antibody [NBP1-80040]

Western Blot: Neuro D4 Antibody [NBP1-80040]

Western Blot: Neuro D4 Antibody [NBP1-80040] - Host: Rat. Target Name: DPF1. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml
Western Blot: Neuro D4 Antibody [NBP1-80040]

Western Blot: Neuro D4 Antibody [NBP1-80040]

Western Blot: Neuro D4 Antibody [NBP1-80040] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Neuro D4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neuro D4

Conserved gene encoding a human 353 amino acid neural specific zinc finger protein which was designated neuro d4. A cysteine and histidine rich region of the C terminus distinguishes members of this family from other zinc finger proteins. The human and rat cDNAs are 93% identical and only 3 amino acid differences are observed between the proteins. Different alternatively spliced cDNAs can be observed. The gene has been mapped to chromosome 19 using chromosomal somatic cell hybrid panels.

Alternate Names

BAF45B, BRG1-associated factor 45B, D4, zinc and double PHD fingers family 1NEUD4BAF45b, MGC150428, MGC150429, neuro-d4, neuro-d4 homolog, zinc finger protein neuro-d4

Gene Symbol

DPF1

Additional Neuro D4 Products

Product Documents for Neuro D4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Neuro D4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neuro D4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neuro D4 Antibody - BSA Free and earn rewards!

Have you used Neuro D4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...