Neurokinin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92178

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Neurokinin B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Neurokinin B Antibody [NBP1-92178]

Immunocytochemistry/ Immunofluorescence: Neurokinin B Antibody [NBP1-92178]

Immunocytochemistry/Immunofluorescence: Neurokinin B Antibody [NBP1-92178] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178]

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178]

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Neurokinin B Antibody

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] -

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] -Staining of human Placenta shows weak cytoplasmic positivity in syncytiotrophoblast.
Neurokinin B Antibody

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] -

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] -Staining of human Liver shows no positivity in hepatocytes as expected.
Neurokinin B Antibody

Immunocytochemistry/Immunofluorescence: Neurokinin B Antibody [NBP1-92178] -

Immunocytochemistry/Immunofluorescence: Neurokinin B Antibody [NBP1-92178] -Staining of Mouse brain shows moderate positivity in cells in molecular layer in the cerebellum.
Neurokinin B Antibody - BSA Free Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Staining of human Liver shows no positivity in hepatocytes as expected.
Neurokinin B Antibody - BSA Free Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Immunofluorescence staining of Mouse brain shows moderate positivity in cells in molecular layer in the cerebellum.
Neurokinin B Antibody - BSA Free Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Staining of human Cerebellum shows strong cytoplasmic positivity in Purkinje cells and neuronal processes.
Neurokinin B Antibody - BSA Free Western Blot: Neurokinin B Antibody - BSA Free [NBP1-92178]

Western Blot: Neurokinin B Antibody - BSA Free [NBP1-92178]

Analysis in control (vector only transfected HEK293T lysate) and TAC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Neurokinin B Antibody - BSA Free Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Immunohistochemistry: Neurokinin B Antibody - BSA Free [NBP1-92178]

Staining of human Placenta shows weak cytoplasmic positivity in syncytiotrophoblast.

Applications for Neurokinin B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neurokinin B

The Neurokinins, also known as Tachykinins, belong to an evolutionary conserved family of peptide neurotransmitters that share a c-terminal sequence and have an established role in neurotransmission. The mammalian tachykinins include substance P (NK1), neurokinin A (NKA) and neurokinin B (NKB) which exert their effects by binding to specific receptors. Tachykinin peptides are important in the mediation of many physiological and pathological processes including inflammation, pain, migraine headache and allergy induced asthma.

Three tachykinin receptor types have been characterized, NK-1, NK-2 and NK-3 which have preferential affinities for SP, NKA and NKB respectively. All three receptors share a high degree of sequence homology, have seven transmembrane spanning domains and similar signal transduction mechanisms (e.g. G-protein coupled activation of phospholipase C).

Alternate Names

gamma tachykinin 3, neurokinin beta, neurokinin B-like, neuromedin K, preprotachykinin B, PRO1155, tachykinin 3, tachykinin-3, ZNEUROK1NKNBNKB

Gene Symbol

TAC3

Additional Neurokinin B Products

Product Documents for Neurokinin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Neurokinin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neurokinin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neurokinin B Antibody - BSA Free and earn rewards!

Have you used Neurokinin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...