NFATC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57613

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('ETRGTTGCAQPPAVSFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGYNKVGPGYGPGE',)

Reactivity Notes

Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NFATC4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NFATC4 Antibody [NBP2-57613]

Immunocytochemistry/ Immunofluorescence: NFATC4 Antibody [NBP2-57613]

Immunocytochemistry/Immunofluorescence: NFATC4 Antibody [NBP2-57613] - Staining of human cell line HUVEC TERT2 shows localization to nuclear speckles & cytosol.
NFATC4 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: NFATC4 Antibody - BSA Free [NBP2-57613]

Chromatin Immunoprecipitation-exo-Seq: NFATC4 Antibody - BSA Free [NBP2-57613]

ChIP-Exo-Seq composite graph for Anti-NFATC4 (NBP2-57613) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for NFATC4 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFATC4

NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a pre-existing cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.

Alternate Names

NF-AT3, NFAT3nuclear factor of activated T-cells, cytoplasmic 4, NFATc4, NF-ATc4, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4, T cell transcription factor NFAT3, T-cell transcription factor NFAT3

Gene Symbol

NFATC4

Additional NFATC4 Products

Product Documents for NFATC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFATC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFATC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFATC4 Antibody - BSA Free and earn rewards!

Have you used NFATC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...