NFkB p105/p50 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87758

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq, Knockdown Validated

Cited:

ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NFkB p105/p50 Antibody - BSA Free

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining in human lymph node and cerebral cortex tissues using NBP1-87758 antibody. Corresponding NFKB1 RNA-seq data are presented for the same tissues.
Western Blot: NFkB p105/p50 Antibody [NBP1-87758]

Western Blot: NFkB p105/p50 Antibody [NBP1-87758]

Western Blot: NFkB p105/p50 Antibody [NBP1-87758] - Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NFKB1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP1-87758]

Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP1-87758]

Immunocytochemistry/Immunofluorescence: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Western Blot: NFkB p105/p50 Antibody [NBP1-87758]

Western Blot: NFkB p105/p50 Antibody [NBP1-87758]

Western Blot: NFkB p105/p50 Antibody [NBP1-87758] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human colon shows moderate cytoplasmic positivity in glandular and lymphoid cells.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human lymph node shows strong cytoplasmic positivity in germinal- and non-germinal center cells.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758]

Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
NFkB p105/p50 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: NFkB p105/p50 Antibody - BSA Free [NBP1-87758]

Chromatin Immunoprecipitation-exo-Seq: NFkB p105/p50 Antibody - BSA Free [NBP1-87758]

ChIP-Exo-Seq composite graph for Anti-NFKB1 (NBP1-87758) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for NFkB p105/p50 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFkB p105/p50

NFkB is a transcription regulator that is activated by various intra and extra cellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Serine 529 is located in a negatively charged region (amino acids 422-540) that is phosphorylated in response to phorbol myristate acetate plus calcium ionophore activation. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth.

Alternate Names

DKFZp686C01211, DNA binding factor KBF1, DNA-binding factor KBF1, EBP-1, KBF1, NF-kappaB, NF-kappa-B, NF-kappabeta, NFKB-p105, NFKB-p50, nuclear factor kappa-B DNA binding subunit, nuclear factor NF-kappa-B p105 subunit, nuclear factor NF-kappa-B p50 subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151, p105, p50

Gene Symbol

NFKB1

Additional NFkB p105/p50 Products

Product Documents for NFkB p105/p50 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFkB p105/p50 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NFkB p105/p50 Antibody - BSA Free

Customer Reviews for NFkB p105/p50 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFkB p105/p50 Antibody - BSA Free and earn rewards!

Have you used NFkB p105/p50 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...