NIR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56687

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NIR2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA

Reactivity Notes

Mouse 83%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NIR2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NIR2 Antibody [NBP2-56687]

Immunocytochemistry/ Immunofluorescence: NIR2 Antibody [NBP2-56687]

Immunocytochemistry/Immunofluorescence: NIR2 Antibody [NBP2-56687] - Staining of human cell line HaCaT shows localization to cytosol & microtubule organizing center.

Applications for NIR2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NIR2

NIR2 belongs to a family of proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein. Nir2, a human homolog of Drosophila melanogaster retinal degeneration B protein, is essential for cytokinesis. A specific Thr residue in the Nir2 PI-transfer domain provides a regulatory site for targeting to lipid droplets. This may affect intracellular lipid trafficking and distribution & explain the dominant effect of the RdgB-T59E mutant on retinal degeneration.

Alternate Names

DRES9NIR-2, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated phosphatidylinositol transfer protein 1, NIR2PITPNM, phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2, PITPnm 1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1, retinal degeneration B alpha 1

Gene Symbol

PITPNM1

Additional NIR2 Products

Product Documents for NIR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NIR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NIR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NIR2 Antibody - BSA Free and earn rewards!

Have you used NIR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies