NOP58 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38111

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1).

Sequence:
RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NOP58 Antibody - BSA Free

NOP58 Antibody

Immunocytochemistry/ Immunofluorescence: NOP58 Antibody [NBP3-38111] -

Immunocytochemistry/ Immunofluorescence: NOP58 Antibody [NBP3-38111] - Immunofluorescence analysis of L929 cells using NOP58 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NOP58 Antibody

Immunocytochemistry/ Immunofluorescence: NOP58 Antibody [NBP3-38111] -

Immunocytochemistry/ Immunofluorescence: NOP58 Antibody [NBP3-38111] - Immunofluorescence analysis of H9C2 cells using NOP58 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NOP58 Antibody

Western Blot: NOP58 Antibody [NBP3-38111] -

Western Blot: NOP58 Antibody [NBP3-38111] - Western blot analysis of various lysates using NOP58 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
NOP58 Antibody

Immunocytochemistry/ Immunofluorescence: NOP58 Antibody [NBP3-38111] -

Immunocytochemistry/ Immunofluorescence: NOP58 Antibody [NBP3-38111] - Immunofluorescence analysis of U2OS cells using NOP58 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for NOP58 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NOP58

Nop5p (a.k.a. Nop58p), is localized in the nucleolus and required for pre-18S rRNA processing in Saccharomyces cerevisiae (baker's yeast).

Alternate Names

HSPC120, NOL5, NOP5/NOP58, NOP58 ribonucleoprotein homolog (yeast), NOP5nucleolar protein 58, Nucleolar protein 5, nucleolar protein NOP5/NOP58

Gene Symbol

NOP58

Additional NOP58 Products

Product Documents for NOP58 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NOP58 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOP58 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOP58 Antibody - BSA Free and earn rewards!

Have you used NOP58 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...