NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free

Novus Biologicals | Catalog # H00004891-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 4G2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF

Specificity

SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (4G2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: NRAMP2/SLC11A2/DMT1 Antibody (4G2) [H00004891-M03]

Immunocytochemistry/ Immunofluorescence: NRAMP2/SLC11A2/DMT1 Antibody (4G2) [H00004891-M03]

Immunocytochemistry/Immunofluorescence: NRAMP2/SLC11A2/DMT1 Antibody (4G2) [H00004891-M03] - Analysis of monoclonal antibody to SLC11A2 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4G2) [H00004891-M03]

ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4G2) [H00004891-M03]

ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4G2) [H00004891-M03] - Detection limit for recombinant GST tagged SLC11A2 is approximately 0.03ng/ml as a capture antibody.

Applications for NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NRAMP2/SLC11A2

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]

Long Name

Natural Resistance-associated Macrophage Protein 2

Alternate Names

DCT1, SLC11A2

Entrez Gene IDs

4891 (Human)

Gene Symbol

SLC11A2

Additional NRAMP2/SLC11A2 Products

Product Documents for NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free and earn rewards!

Have you used NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (4G2) - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Do you have a primary anti-DMT1 antibody against mouse for Western Blot?

    A: We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an Innovators Reward Program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...