NRSF Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82399
![Western Blot: NRSF Antibody [NBP1-82399]](https://resources.rndsystems.com/images/products/NRSF-Antibody-Western-Blot-NBP1-82399-img0002.jpg "Western Blot: NRSF Antibody [NBP1-82399]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Species Reactivity
Mouse
Applications
Validated:
Western Blot
Cited:
Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide towards Rest. Peptide sequence ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for NRSF Antibody - BSA Free
Western Blot: NRSF Antibody [NBP1-82399]
Western Blot: NRSF Antibody [NBP1-82399] - Mouse Heart Lysate 1ug/ml Gel Concentration 6-18%
Western Blot: NRSF Antibody - BSA Free [NBP1-82399] -
Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Western Blot: NRSF Antibody - BSA Free [NBP1-82399] -
Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Western Blot: NRSF Antibody - BSA Free [NBP1-82399] -
Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Immunocytochemistry/ Immunofluorescence: NRSF Antibody - BSA Free [NBP1-82399] -
Expression and distribution of REST after treatment of HGP a Western blotting image of REST in PC12 cells at control and HGP. b Western blotting image of REST in PCNs at control and HGP. c Immunofluorescence staining of REST in PCNs at Day5, Day10 and HGP. Scale bar, 25 μm. d Nuclear fluorescence intensity of REST. e The expression level of REST in cytoplasm and nucleus of PC12 cells under HGP. Data are mean +/- SD. n = 3 independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Unpaired t test for (a), (b) and (e). One-way ANOVA for (d) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35850767), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for NRSF Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Application Notes
Use in Immunohistochemistry-frozen and Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID:31706914).
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: REST/NRSF
Long Name
RE1-Silencing Transcription Factor
Alternate Names
NRSF, XBR
Gene Symbol
REST
UniProt
Additional REST/NRSF Products
Product Documents for NRSF Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NRSF Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for NRSF Antibody - BSA Free
Powered by Bioz
Customer Reviews for NRSF Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NRSF Antibody - BSA Free and earn rewards!
Have you used NRSF Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...