NSUN5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89416

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NSUN5 Antibody - BSA Free

NSUN5 Antibody - BSA Free Western Blot: NSUN5 Antibody - BSA Free [NBP1-89416]

Western Blot: NSUN5 Antibody - BSA Free [NBP1-89416]

Analysis in human cell lines Caco-2 and U-251MG using Anti-NSUN5 antibody. Corresponding NSUN5 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
NSUN5 Antibody - BSA Free Western Blot: NSUN5 Antibody - BSA Free [NBP1-89416]

Western Blot: NSUN5 Antibody - BSA Free [NBP1-89416]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NSUN5 Antibody [NBP1-89416]

Immunocytochemistry/ Immunofluorescence: NSUN5 Antibody [NBP1-89416]

Immunocytochemistry/Immunofluorescence: NSUN5 Antibody [NBP1-89416] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSUN5 Antibody [NBP1-89416]

Immunohistochemistry-Paraffin: NSUN5 Antibody [NBP1-89416]

Immunohistochemistry-Paraffin: NSUN5 Antibody [NBP1-89416] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.

Applications for NSUN5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NSUN5

NSUN5 encodes a protein with similarity to p120 (NOL1), a 120-kDa proliferation-associated nucleolar antigen that is a member of an evolutionarily conserved protein family. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

EC 2.1.1.-, FLJ10267, member 5A, MGC986, NOL1, NOL1/NOP2/Sun domain family member 5, NOL1/NOP2/Sun domain family, member 5, NOL1R(NOL1), NOL1-related protein, NOP2/Sun domain family, member 5, NSUN5A, p120, putative methyltransferase NSUN5, WBSCR20, WBSCR20A, Williams-Beuren syndrome chromosomal region 20A protein, Williams-Beuren syndrome critical region protein 20 copy A, Ynl022cL

Gene Symbol

NSUN5

Additional NSUN5 Products

Product Documents for NSUN5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NSUN5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NSUN5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NSUN5 Antibody - BSA Free and earn rewards!

Have you used NSUN5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...