Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69226

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to NFE2 (nuclear factor (erythroid-derived 2), 45kDa) The peptide sequence was selected from the N terminal of NFE2. Peptide sequence MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-69226]

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-69226]

Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-69226] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Applications for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nuclear Factor Erythroid Derived 2

NFE2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. NFE2 binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. NFE2 is requires MAFK or other small MAF proteins for binding to the NF-E2 motif. NFE2 may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.

Alternate Names

Leucine zipper protein NF-E2, NF-E2, nuclear factor (erythroid-derived 2), 45kD, nuclear factor (erythroid-derived 2), 45kDa, Nuclear factor, erythroid-derived 2 45 kDa subunit, p45, p45 NF-E2, transcription factor NF-E2 45 kDa subunit

Gene Symbol

NFE2

UniProt

Additional Nuclear Factor Erythroid Derived 2 Products

Product Documents for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nuclear Factor Erythroid Derived 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nuclear Factor Erythroid Derived 2 Antibody - BSA Free and earn rewards!

Have you used Nuclear Factor Erythroid Derived 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...