Nuf2 Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-75277

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all Nuf2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF

Reactivity Notes

Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. As a result, each order represents a unique lot.

Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Free biotin from the conjugation process has been removed. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for Nuf2 Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product

NBP2-55985

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Nuf2

Nuf2, also known as Kinetochore protein Nuf2, is a 54 kDa 464 amino acid protein, and it is involved in chromosome segregation, specifically as it relates to spindle checkpoint activity with the kinetochore-associated NDC80 complex. This protein is necessary for kinetochore stability and organization of microtubule binding sites on the outer plate, forming interactions with NDC80/HEC-1-CDCA1, SPBC24-SPBC25, Bub1, EXOC1, as well as AURKB/Aurora-B and CENPE in the mitotic prometaphase, DNA replication, and Cell Cycle pathways. Current research is being performed on this proteins involvement in gastric, lung, and breast cancers, in addition to essential hypertension, schizophrenia, and duodenogastric reflux.

Alternate Names

cancer/testis antigen 106, CDCA1hsNuf2, cell division cycle associated 1, Cell division cycle-associated protein 1, CT106, hNuf2, kinetochore protein Nuf2, NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae), NUF2RhNuf2R

Gene Symbol

NUF2

Additional Nuf2 Products

Product Documents for Nuf2 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nuf2 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nuf2 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review Nuf2 Antibody [Biotin] and earn rewards!

Have you used Nuf2 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies