NuMA Antibody (6D4I4)

Novus Biologicals | Catalog # NBP3-16411

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6D4I4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 2000-2100 of human NuMA1 (Q14980). TPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NuMA Antibody (6D4I4)

Western Blot: NuMA Antibody (6D4I4) [NBP3-16411]

Western Blot: NuMA Antibody (6D4I4) [NBP3-16411]

Western Blot: NuMA Antibody (6D4I4) [NBP3-16411] - Western blot analysis of extracts of various cell lines, using NuMA1 Rabbit mAb (NBP3-16411) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded mouse testis tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded rat lung tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded mouse intestin tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded human thyroid cancer tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded mouse liver tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded rat brain tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded human spleen tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded mouse lung tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded rat colon tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
NuMA Antibody (6D4I4)

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] -

Immunohistochemistry: NuMA Antibody (6D4I4) [NBP3-16411] - Immunohistochemistry analysis of NuMA in paraffin-embedded mouse spleen tissue using NuMA Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for NuMA Antibody (6D4I4)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NuMA

NuMA (nuclear mitotic apparatus) is a long coiled-coil protein that plays a role in the interphase and mitosis phases of a cell cycle. In interphase, it has been hypothesized to play a structural role in the nucleoskeleton that may be important in nuclear organization and functions. During mitosis, it is associated with spindle microtubule organization and chromosome positioning. Therefore, this antibody is useful as a cell cycle marker.

Long Name

Nuclear Mitotic Apparatus Protein 1

Alternate Names

NMP-22, NUMA1, SP-H Antigen

Gene Symbol

NUMA1

Additional NuMA Products

Product Documents for NuMA Antibody (6D4I4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NuMA Antibody (6D4I4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NuMA Antibody (6D4I4)

There are currently no reviews for this product. Be the first to review NuMA Antibody (6D4I4) and earn rewards!

Have you used NuMA Antibody (6D4I4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...