O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Novus Biologicals | Catalog # NBP3-16203

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3Q9B8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 947-1046 of human O-GlcNAc Transferase p110 subunit (O15294). PGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203]

Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203]

Western Blot: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] - Western blot analysis of extracts of various cell lines, using O-GlcNAc Transferase p110 subunit Rabbit mAb (NBP3-16203) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Chromatin Immunoprecipitation: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] -

Chromatin Immunoprecipitation: O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) [NBP3-16203] - Chromatin immunoprecipitation analysis of extracts of 293T cells, using O-GlcNAc Transferase p110 subunit Rabbit mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Applications for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

1:500 - 1:1000

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: O-GlcNAc Transferase/OGT

Diffusion of metabolites and small non-nuclear molecules as well as active, mediated import of protein and export of protein and RNA through the nuclear envelope occurs through nuclear pore complexes or NPC's. NPC's contain up to 100 different polypeptides which have a combined mass of about 125 megadaltons. The channel available for passive transport through the NPC is about 9-10 nm in diameter while carrier mediated changes in the NPC result in a ~25 nm channel used for larger, actively transported molecules. Of the 100 polypeptides, at least 8 of these are O-linked N-acetylglycosamine-modified in mammalian cells. All of the mammalian O-linked glycoproteins contain multiple copies of phenylalanine, glycine dipeptide repeats dispersed throughout part of their sequence. Studies indicate that the NPC O-linked glycoproteins have a direct role in nuclear protein import.

Long Name

O-Linked N-Acetylglucosamine (GlcNAc) Transferase

Alternate Names

HRNT1, OGlcNAc Transferase, OGT

Gene Symbol

OGT

Additional O-GlcNAc Transferase/OGT Products

Product Documents for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)

There are currently no reviews for this product. Be the first to review O-GlcNAc Transferase p110 subunit Antibody (3Q9B8) and earn rewards!

Have you used O-GlcNAc Transferase p110 subunit Antibody (3Q9B8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...