Opsin 1 (Long Wave) Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09392

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human OPN1MW. Peptide sequence SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Opsin 1 (Long Wave) Antibody - BSA Free

Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392]

Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392]

Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392] - Western blot analysis of Opsin 1 (Long Wave) in Fetal Heart lysates. Antibody dilution at 1.0ug/ml

Applications for Opsin 1 (Long Wave) Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Opsin 1 (Long Wave)

The Opsin 1 (Long Wave) gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal

Alternate Names

CBBM, COD5, cone dystrophy 5 (X-linked), long-wave-sensitive opsin 1, opsin 1 (cone pigments), long-wave-sensitive, RCPcolor blindness, protan, Red cone photoreceptor pigmentCBP, Red-sensitive opsin, ROP

Gene Symbol

OPN1LW

Additional Opsin 1 (Long Wave) Products

Product Documents for Opsin 1 (Long Wave) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Opsin 1 (Long Wave) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Opsin 1 (Long Wave) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Opsin 1 (Long Wave) Antibody - BSA Free and earn rewards!

Have you used Opsin 1 (Long Wave) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...