OR8D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83344

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8D1. Peptide sequence: SKAFGTCSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OR8D1 Antibody - BSA Free

Western Blot: OR8D1 Antibody [NBP2-83344]

Western Blot: OR8D1 Antibody [NBP2-83344]

Western Blot: OR8D1 Antibody [NBP2-83344] - Host: Rabbit. Target Name: OR8D1. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1.0ug/ml

Applications for OR8D1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR8D1

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Alternate Names

JCG9, olfactory receptor 8D1, Olfactory receptor 8D3, Olfactory receptor OR11-301, olfactory receptor, family 8, subfamily D, member 1, olfactory receptor, family 8, subfamily D, member 3, Olfactory receptor-like protein JCG9, olfactory-like receptor JCG9, OR8D3, OST004PDJ9J14

Gene Symbol

OR8D1

Additional OR8D1 Products

Product Documents for OR8D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR8D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR8D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR8D1 Antibody - BSA Free and earn rewards!

Have you used OR8D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...