ORL1/OPRL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69143

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to OPRL1 (opiate receptor-like 1) The peptide sequence was selected from the middle region of OPRL1. Peptide sequence ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ORL1/OPRL1 Antibody - BSA Free

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml OPRL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143]

Western Blot: ORL1/OPRL1 Antibody [NBP1-69143] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Applications for ORL1/OPRL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORL1/OPRL1

The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17 aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Three transcript variants encoding the same protein have been found for this gene.

Long Name

Opioid Receptor-like 1

Alternate Names

KOR-3, N/OFQ Receptor, Nociceptin Receptor, NOCIR, NOP Receptor, OOR, OPRL1, Orphanin FQ Receptor

Gene Symbol

OPRL1

Additional ORL1/OPRL1 Products

Product Documents for ORL1/OPRL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ORL1/OPRL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ORL1/OPRL1 Antibody - BSA Free

Customer Reviews for ORL1/OPRL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ORL1/OPRL1 Antibody - BSA Free and earn rewards!

Have you used ORL1/OPRL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...