OXCT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49331

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OXCT1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OXCT1 Antibody [NBP2-49331]

Immunocytochemistry/ Immunofluorescence: OXCT1 Antibody [NBP2-49331]

Immunocytochemistry/Immunofluorescence: OXCT1 Antibody [NBP2-49331] - Immunofluorescent staining of human cell line SiHa shows localization to mitochondria.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Analysis in human heart muscle and liver tissues. Corresponding OXCT1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human heart muscle, kidney, liver and testis using Anti-OXCT1 antibody NBP2-49331 (A) shows similar protein distribution across tissues to independent antibody NBP1-82462 (B).
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331]

Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for OXCT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OXCT1

OXCT1 encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency. [provided by RefSeq]

Alternate Names

3-oxoacid CoA transferase 1,3-oxoacid CoA transferase, EC 2.8.3, EC 2.8.3.5, SCOTmitochondrial

Gene Symbol

OXCT1

Additional OXCT1 Products

Product Documents for OXCT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OXCT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OXCT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OXCT1 Antibody - BSA Free and earn rewards!

Have you used OXCT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...