P2X4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92239

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YCMKKRLYYREKKYKYVEDYEQGLASELDQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for P2X4 Antibody - BSA Free

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239] - Staining in human placenta and skeletal muscle tissues. Corresponding P2RX4 RNA-seq data are presented for the same tissues.
Western Blot: P2X4 Antibody [NBP1-92239]

Western Blot: P2X4 Antibody [NBP1-92239]

Western Blot: P2X4 Antibody [NBP1-92239] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239] - Staining of human cerebral cortex shows positivity in neurons.
Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239]

Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239] - Staining of human small intestine shows positivity in luminal membrane in glandular cells.
P2X4 Antibody - BSA Free Immunohistochemistry: P2X4 Antibody - BSA Free [NBP1-92239]

Immunohistochemistry: P2X4 Antibody - BSA Free [NBP1-92239]

Analysis in human placenta and skeletal muscle tissues using NBP1-92239 antibody. Corresponding P2RX4 RNA-seq data are presented for the same tissues.
P2X4 Antibody - BSA Free Immunohistochemistry: P2X4 Antibody - BSA Free [NBP1-92239]

Immunohistochemistry: P2X4 Antibody - BSA Free [NBP1-92239]

Staining of human skeletal muscle shows weak cytoplasmic-membranous positivity in myocytes.
P2X4 Antibody - BSA Free Western Blot: P2X4 Antibody - BSA Free [NBP1-92239]

Western Blot: P2X4 Antibody - BSA Free [NBP1-92239]

Analysis in human cell line SK-MEL-30.
P2X4 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: P2X4 Antibody [NBP1-92239]

Immunocytochemistry/ Immunofluorescence: P2X4 Antibody [NBP1-92239]

Staining of human cell line U-2 OS shows localization to cytosol & actin filaments.

Applications for P2X4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: P2X4

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants have been identified for this gene although their full-length natures have not been determined. [provided by RefSeq]

Long Name

P2X Purinergic Receptor 4

Alternate Names

P2RX4

Gene Symbol

P2RX4

Additional P2X4 Products

Product Documents for P2X4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P2X4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for P2X4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review P2X4 Antibody - BSA Free and earn rewards!

Have you used P2X4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...