P2Y12/P2RY12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35719

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 243-342 of human P2Y12/P2RY12 (NP_795345.1).

Sequence:
INFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for P2Y12/P2RY12 Antibody - BSA Free

P2Y12/P2RY12 Antibody

Western Blot: P2Y12/P2RY12 Antibody [NBP3-35719] -

Western Blot: P2Y12/P2RY12 Antibody [NBP3-35719] - Western blot analysis of lysates from Mouse brain using P2Y12/P2RY12 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.
P2Y12/P2RY12 Antibody

Western Blot: P2Y12/P2RY12 Antibody [NBP3-35719] -

Western Blot: P2Y12/P2RY12 Antibody [NBP3-35719] - Western Blot analysis of lysates from Mouse brain using P2Y12/P2RY12 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.

Applications for P2Y12/P2RY12 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: P2Y12/P2RY12

P2Y12 is a Purinergic Receptor essential for the aggregation of blood platelets. There is evidence that mutations in P2Y12 cause a bleeding disorder, suggesting that knowledge of the P2Y12 receptor could advance the development of antiplatelet agents to treat cardiovascular diseases. Expression of P2Y12 has been reported in platelets, spinal cord, and many brain regions. ESTs for P2Y12 have been isolated from B-cell/lung/testis, brain, embryo, prostate, eye, kidney carcinoma, and colon carcinoma libraries. Cognate

Long Name

P2Y Purinergic Receptor 12

Alternate Names

ADPG-R, HORK3, P2RY12, SP1999

Gene Symbol

P2RY12

Additional P2Y12/P2RY12 Products

Product Documents for P2Y12/P2RY12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P2Y12/P2RY12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for P2Y12/P2RY12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review P2Y12/P2RY12 Antibody - BSA Free and earn rewards!

Have you used P2Y12/P2RY12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...