PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00005720-B01P

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

PSME1 (AAH00352, 1 a.a. - 249 a.a.) full-length human protein. MAMLRVQPEAQAKVDVFREDLCTKAENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Specificity

PSME1 - proteasome (prosome, macropain) activator subunit 1 (PA28 alpha),

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P]

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P]

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P] - Analysis of PSME1 expression in A-431.
Immunocytochemistry/ Immunofluorescence: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P]

Immunocytochemistry/ Immunofluorescence: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P]

Immunocytochemistry/Immunofluorescence: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P] - Analysis of purified antibody to PSME1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P]

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P]

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P] - Analysis of PSME1 expression in transfected 293T cell line by PSME1 polyclonal antibody. Lane 1: PSME1 transfected lysate(27.5 KDa). Lane 2: Non-transfected lysate.

Applications for PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PA28 Activator alpha Subunit

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Two transcripts encoding different isoforms have been identified. [provided by RefSeq]

Long Name

Proteasome (Prosome, Macropain) Activator Subunit 1

Alternate Names

11S Regulator Complex Subunit alpha, IFI5111, PSME1, REG alpha

Entrez Gene IDs

5720 (Human)

Gene Symbol

PSME1

Additional PA28 Activator alpha Subunit Products

Product Documents for PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free and earn rewards!

Have you used PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...