PAMCI Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80938

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAMCI Antibody - BSA Free

Western Blot: PAMCI Antibody [NBP1-80938]

Western Blot: PAMCI Antibody [NBP1-80938]

Western Blot: PAMCI Antibody [NBP1-80938] - Analysis using Anti-RASSF9 antibody NBP1-80938 (A) shows similar pattern to independent antibody NBP1-80937 (B).
PAMCI Antibody - BSA Free Immunohistochemistry: PAMCI Antibody [NBP1-80938]

Immunohistochemistry: PAMCI Antibody [NBP1-80938]

Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Western Blot: PAMCI Antibody [NBP1-80938]

Western Blot: PAMCI Antibody [NBP1-80938]

Western Blot: PAMCI Antibody [NBP1-80938] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
PAMCI Antibody - BSA Free Immunohistochemistry: PAMCI Antibody [NBP1-80938]

Immunohistochemistry-Paraffin: PAMCI Antibody [NBP1-80938]

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
PAMCI Antibody - BSA Free Immunohistochemistry: PAMCI Antibody [NBP1-80938]

Immunohistochemistry: PAMCI Antibody [NBP1-80938]

Staining of human breast shows strong membranous positivity in glandular cells.
PAMCI Antibody - BSA Free Immunohistochemistry: PAMCI Antibody [NBP1-80938]

Immunohistochemistry: PAMCI Antibody [NBP1-80938]

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Applications for PAMCI Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAMCI

The protein encoded by the PAMCI gene localizes to perinuclear endosomes. This protein associates with peptidylglycine alpha-amidating monooxygenase, and may be involved with the trafficking of this enzyme through secretory or endosomal pathways. (provided by RefSeq)

Alternate Names

PAM COOH-terminal interactor protein 1, PAMCI, PCIP1, P-CIP1peptidylglycine alpha-amidating monooxygenase COOH-terminal interactorprotein-1, Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor, Ras association (RalGDS/AF-6) domain family (N-terminal) member 9, ras association domain-containing protein 9

Entrez Gene IDs

9182 (Human)

Gene Symbol

RASSF9

UniProt

Additional PAMCI Products

Product Documents for PAMCI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAMCI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAMCI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAMCI Antibody - BSA Free and earn rewards!

Have you used PAMCI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...