PATJ Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58843

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to INADL(InaD-like (Drosophila)) The peptide sequence was selected from the N terminal of INADL. Peptide sequence EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PATJ Antibody - BSA Free

Western Blot: PATJ Antibody [NBP1-58843]

Western Blot: PATJ Antibody [NBP1-58843]

Western Blot: PATJ Antibody [NBP1-58843] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for PATJ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PATJ

INADL is a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

channel-interacting PDZ domain protein, FLJ26982, hINADL, inactivation no after-potential D-like protein, Inadl protein, InaD-like, InaD-like (Drosophila), inaD-like protein, Pals1-associated tight junction protein, PATJCipp, PDZ domain protein, Protein associated to tight junctions

Gene Symbol

INADL

UniProt

Additional PATJ Products

Product Documents for PATJ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PATJ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PATJ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PATJ Antibody - BSA Free and earn rewards!

Have you used PATJ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...