PCPTP1 Antibody (5R6L5)

Novus Biologicals | Catalog # NBP3-33262

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 5R6L5
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCPTP1 (Q15256).

Sequence:
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PCPTP1 Antibody (5R6L5)

PCPTP1 Antibody (5R6L5)

Western Blot: PCPTP1 Antibody (5R6L5) [NBP3-33262] -

Western Blot: PCPTP1 Antibody (5R6L5) [NBP3-33262] - Western blot analysis of various lysates using PCPTP1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for PCPTP1 Antibody (5R6L5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PCPTP1

PCPTP1, also known as Receptor-type tyrosine-protein phosphatase R, has 4 isoforms, a 657 amino acid isoform that is 74 kDa, a 412 amino acid isoform t5hat is 47 k Da, a 451 amino acid isoform that is 51 kDa, and a 545 amino acid isoform that is 61 kDa, expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate, sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. The protein is being studied for its involvement in colorectal cancer, episodic ataxia, ataxia, leukemia, prostatitis, and neuronitis. This protein has also been shown to involve MAPK1, MAPK14, MAPK3, MAPK7, and CDH2 in MAPK signaling pathway, EGFR1 Signaling Pathway, Signal transduction Erk Interactions- Inhibition of Erky, and Epithelial Adherens Junctions pathways.

Alternate Names

Ch-1 PTPase, ch-1PTPase, DKFZp781C1038, EC 3.1.3.48, ECPTP, EC-PTP, FLJ34328, MGC131968, MGC148170, NC-PTPCOM1, PCPTP1, protein tyrosine phosphatase Cr1PTPase, protein tyrosine phosphatase, receptor type, R, protein-tyrosine phosphatase NC-PTPCOM1, Protein-tyrosine phosphatase PCPTP1, PTPBR7, PTPRQ, PTP-SL, receptor-type tyrosine-protein phosphatase R, R-PTP-R

Gene Symbol

PTPRR

Additional PCPTP1 Products

Product Documents for PCPTP1 Antibody (5R6L5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCPTP1 Antibody (5R6L5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCPTP1 Antibody (5R6L5)

There are currently no reviews for this product. Be the first to review PCPTP1 Antibody (5R6L5) and earn rewards!

Have you used PCPTP1 Antibody (5R6L5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...