PDE6G Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93029

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human PDE6G (NP_002593.1). MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PDE6G Antibody - Azide and BSA Free

Western Blot: PDE6G AntibodyAzide and BSA Free [NBP2-93029]

Western Blot: PDE6G AntibodyAzide and BSA Free [NBP2-93029]

Western Blot: PDE6G Antibody [NBP2-93029] - Analysis of extracts of various cell lines, using PDE6G at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: PDE6G Antibody - Azide and BSA Free [NBP2-93029]

Immunocytochemistry/ Immunofluorescence: PDE6G Antibody - Azide and BSA Free [NBP2-93029]

Immunocytochemistry/Immunofluorescence: PDE6G Antibody [NBP2-93029] - Analysis of U-2 OS cells using PDE6G at dilution of 1:100. Blue: DAPI for nuclear staining.
PDE6G Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PDE6G Antibody - Azide and BSA Free [NBP2-93029] -

Immunocytochemistry/ Immunofluorescence: PDE6G Antibody - Azide and BSA Free [NBP2-93029] - Immunofluorescence analysis of L929 cells using PDE6G Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PDE6G Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PDE6G Antibody - Azide and BSA Free [NBP2-93029] -

Immunocytochemistry/ Immunofluorescence: PDE6G Antibody - Azide and BSA Free [NBP2-93029] - Immunofluorescence analysis of C6 cells using PDE6G Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for PDE6G Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PDE6G

PDE6G encodes the gamma subunit of cyclic GMP-phosphodiesterase, which is composed of alpha- and beta- catalytic subunits and two identical, inhibitory gamma subunits. PDE6G is expressed in rod photoreceptors and functions in the phototransduction signaling cascade. PDE6G is also expressed in a variety of other tissues, and has been shown to regulate the c-Src protein kinase and G-protein-coupled receptor kinase 2. Alternative splicing results in multiple transcript variants.

Long Name

Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma

Alternate Names

GMP-PDE gamma, PDEG

Gene Symbol

PDE6G

Additional PDE6G Products

Product Documents for PDE6G Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PDE6G Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for PDE6G Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PDE6G Antibody - Azide and BSA Free and earn rewards!

Have you used PDE6G Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...