Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38312

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Phosphoribosyl Pyrophosphate Amidotransferase (NP_002694.3).

Sequence:
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Phosphoribosyl Pyrophosphate Amidotransferase Antibody

Immunocytochemistry/ Immunofluorescence: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP3-38312] -

Immunocytochemistry/ Immunofluorescence: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP3-38312] - Immunofluorescence analysis of HeLa cells using Phosphoribosyl Pyrophosphate Amidotransferase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Phosphoribosyl Pyrophosphate Amidotransferase Antibody

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP3-38312] -

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP3-38312] - Western blot analysis of lysates from Rat spleen, using Phosphoribosyl Pyrophosphate Amidotransferase Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Phosphoribosyl Pyrophosphate Amidotransferase

Phosphoribosyl Pyrophosphate Amidotransferase is encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Alternate Names

ATASE, EC 2.4.2.14, glutamine phosphoribosylpyrophosphatate amidotransferase, Glutamine phosphoribosylpyrophosphate amidotransferase, glutamine PRPP amidotransferase, GPATamidophosphoribosyltransferase, phosphoribosyl pyrophosphate amidotransferase, PRAT

Gene Symbol

PPAT

Additional Phosphoribosyl Pyrophosphate Amidotransferase Products

Product Documents for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free and earn rewards!

Have you used Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...