PI 3-Kinase p110 delta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38535

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PI 3-Kinase p110 delta Antibody - BSA Free

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Analysis in human lymph node and skeletal muscle tissues using NBP2-38535 antibody. Corresponding PIK3CD RNA-seq data are presented for the same tissues.
Western Blot: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Western Blot: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Western Blot: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Lane 1: Marker [kDa] 250,130,100,70,55,35,25,15,10. Lane 2: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunocytochemistry/ Immunofluorescence: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunocytochemistry/Immunofluorescence: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytokinetic bridge & vesicles.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535]

Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for PI 3-Kinase p110 delta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PI 3-Kinase p110 delta

PI3-Kinases (PI3-Ks) are a family of lipid kinases that are implicated in signal transduction. PI3-K consists of two subunits; p85 and p110. The p85 subunit localize PI3-K activity to the plasma membrane while the p110 subunit contains the catalytic domain of PI3-K. Four isoforms of p110 has been found; the alpha, beta, gamma, and the delta subunit. The delta isoform is predominantly expressed in leukocytes and has been shown to interact with p85 and GTP-bound Ras via its SH2/SH3 domain.

Long Name

Protein Tyrosine Phosphatase 1D

Alternate Names

PI 3Kinase p110 delta, PIK3CD

Gene Symbol

PIK3CD

Additional PI 3-Kinase p110 delta Products

Product Documents for PI 3-Kinase p110 delta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PI 3-Kinase p110 delta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PI 3-Kinase p110 delta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PI 3-Kinase p110 delta Antibody - BSA Free and earn rewards!

Have you used PI 3-Kinase p110 delta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies