PI 3-Kinase p85 beta Antibody (6E2F5)
Novus Biologicals | Catalog # NBP3-16493
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Rat
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6E2F5 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI 3-Kinase p85 beta (O00459). PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for PI 3-Kinase p85 beta Antibody (6E2F5)
Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]
Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493] - Western blot analysis of extracts of various cell lines, using PI 3-Kinase p85 beta antibody (NBP3-16493) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Applications for PI 3-Kinase p85 beta Antibody (6E2F5)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: PI 3-Kinase p85 beta
Long Name
Phosphatidylinositol-3-kinase 85 kDa Regulatory Subunit beta
Alternate Names
p85-beta, PI 3Kinase p85 beta, PIK3R2
Gene Symbol
PIK3R2
Additional PI 3-Kinase p85 beta Products
Product Documents for PI 3-Kinase p85 beta Antibody (6E2F5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PI 3-Kinase p85 beta Antibody (6E2F5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PI 3-Kinase p85 beta Antibody (6E2F5)
There are currently no reviews for this product. Be the first to review PI 3-Kinase p85 beta Antibody (6E2F5) and earn rewards!
Have you used PI 3-Kinase p85 beta Antibody (6E2F5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
Common Cytokine Receptor Gamma-Chain Family Signaling Pathways
IL-2 Signaling Pathways
IL-4 Signaling Pathways
IL-7 Signaling Pathways
IL-9 Signaling Pathways
IL-15 Signaling Pathways
IL-21 Signaling Pathways
mTOR Signaling Pathway
Notch Signaling Pathways
TGF-beta Signaling Pathways
VEGF - VEGF R2 Signaling Pathways